PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10013623m
Common NameCARUB_v10013623mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family WRKY
Protein Properties Length: 470aa    MW: 51218.4 Da    PI: 8.2466
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10013623mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1017.3e-32208264259
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      dDgynWrKYGqK++kg e+prsYY+Ct+ +Cpvkkkvers+ d+++++i+Y+g+H+he
  Carubv10013623m 208 DDGYNWRKYGQKPIKGCEYPRSYYKCTHVNCPVKKKVERSS-DGQITQIIYKGQHDHE 264
                      8****************************************.***************8 PP

2WRKY105.13.7e-33355413159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      ldDgy+WrKYGqK+vkg+++prsYY+Ct+a+C+v+k+ver+++d k+v++tYeg+Hnh+
  Carubv10013623m 355 LDDGYRWRKYGQKVVKGNPHPRSYYKCTTANCTVRKHVERASTDAKAVITTYEGKHNHD 413
                      59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.4E-28200266IPR003657WRKY domain
SuperFamilySSF1182902.22E-25205266IPR003657WRKY domain
SMARTSM007743.4E-35207265IPR003657WRKY domain
PfamPF031061.5E-24208263IPR003657WRKY domain
PROSITE profilePS5081124.03208266IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.5E-36340415IPR003657WRKY domain
SuperFamilySSF1182904.32E-29347415IPR003657WRKY domain
PROSITE profilePS5081137.734350415IPR003657WRKY domain
SMARTSM007743.8E-38355414IPR003657WRKY domain
PfamPF031061.6E-25356413IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0031347Biological Processregulation of defense response
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top